Host-defense peptides (HDPs) are vital components of innate immunity in all vertebrates.
While their antibacterial activity toward bacterial cells was the original focus for research …

Bioactive peptides, specific protein fragments with positive health effects, are gaining
traction in drug development for advantages like enhanced penetration, low toxicity, and …

Crotalicidin (Ctn), a cathelicidin-related peptide from the venom of a South American
rattlesnake, possesses potent antimicrobial, antitumor, and antifungal properties. Previously …

Bioactive small molecules isolated from animals, plants, fungi and bacteria, including natural
antimicrobial peptides, have shown great therapeutic potential worldwide. Among these …

For decades, natural products in general and snake venoms (SV) in particular have been a
rich source of bioactive compounds for drug discovery, and they remain a promising …

Simple Summary A critical global health problem is microbial resistance to antibiotics. In
order to further discuss this issue and search for practical means to overcome such …

Abstract Porcine protegrin-1 (PG-1) is a broad-spectrum antimicrobial peptide (AMP) with
potent antimicrobial activities. We produced recombinant PG-1 and evaluated its cytotoxicity …

Antimicrobial peptides (AMPs) hold promise as novel therapeutics in the fight against multi-
drug-resistant pathogens. Cathelicidin-PY (NH2-RKCNFLCKLKEKLRTVITSHIDKVLRPQG …

Temporins are anti-microbial peptides synthesized in the skin of frogs of the Ranidae family.
The few studies to date that have examined their anti-viral properties have shown that they …

Antimicrobial peptides (AMPs) are promising alternatives to existing treatments for multidrug-
resistant bacteria-infected wounds. Therefore, the effect of protegrin-1 (PG1), a potent …